Omega Messenger, WhatsApp Chat
Lever op til Shopifys højeste kvalitetsstandarder for hastighed, brugervenlighed og værdi for shopejere
Anmeldelser (536)
Afgræns
-
Efter bedømmelse
okokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokok
derwgregergrwgwegwegwegwegwegwegwegqegfqefgqwevgwrgwrgvqemnvklwjfwejkcfvowekdrjKvgfwerkjgvjwreogjvowrjgowrjkgjwrijgiwrjgijwrivgj
Hi jiew82633
We really appreciate that you enjoy using our app! Our customer service team will be glad to know about your review as they try very hard to help and be responsive to our users. Let us know whenever you have any questions about the app.
Best regards!
Omega Team
The app is really simple and easy to set up. Can't wait to see how it works. You should give it a try too.
I was able to receive a prompt response to my question and help from the team. They were able to fix the problem .
Hi Country Gal Thrift
Thank you so much for your review. We are happy that you had a great experience with our app and customer service. Our team is always here to solve any of your problems. Please feel free to contact us again if you need more help. Have a good day!
Kaylee - Omega Team
Chat function not working on my store. Reached out for support but have heard nothing yet. Will update rating when solved.
Hello,
Thanks for your feedback!
I have responded to your email 2 days ago, please check email sunroomplantwares@gmail.com
I have checked and see the issue: "Refused to display" from Facebook API.
I think the issue due to fb page missing whitelist domain or setup private age, country restrict
for manual add whitelist domain: https://developers.facebook.com/docs/messenger-platform/reference/messenger-profile-api/domain-whitelisting/
for setup restrict: https://developers.facebook.com/docs/messenger-platform/discovery/customer-chat-plugin/#login
Regards,
Kien
Beware of what you are giving this app in return for free use!
They inject another Facebook Pixel on my store, a pixel owned by them, collecting my customer data!
You can download the Facebook pixel helper chrome extension to see this for yourself.
UPDATED: Company wrote to me to clarify (as per below). Updated my rating from 1 to 3 stars. I am still not sure if I want to use this.
Hello there,
Thank you for taking your time to write us a review. However, there might be a misunderstanding here. Facebook has put Facebook pixel due to the same Facebook sdk between Facebook chat and pixel. Our app function is to display only, when the app includes sdk.js from Facebook, it also includes the pixel by Facebook default.
However, it does not affect your Pixel account, and we definitely do not collect any customer information from your store. In addition, Facebook does not allow that.
We do hope our explanation is clear enough to make sure there is no misunderstanding here which can affect our future merchants. We created the app to support merchants and build trust for our brand and this comment can make the customers misunderstood our purpose .
We have contacted you via email and contact number if you need any support or any further information.
Please get back to us.
We are looking forward to hearing from you.
Best regards,
Kien
I just installed it. but was very easy to install and chat assistance was ready to help upon installation which was super helpful.
Thanks for taking the time to leave us feedback! We really appreciate it.
We would love to hear more about your experience so that we can use your valuable feedback to deliver an even better experience next time.
Please reach out to us via live chat or email at contact@omegatheme.com with any further comments or suggestions you wish to share.
Again, thank you for taking the time to review our app!
It is very simple to install but when i install it on my shop the desktop live chat doesn't work at all :(
Hello there,
Thanks for your feedback!
I have checked and see you are setting up option display Only Homepage.
So it's app only wok on homepage.
Please change setting for it's work properly.
Regards,
Omega Team Support
Carlos was very polite and understood my problem right away. Basically the widget was not showing on my website and he immediately fixed. Great customer service and look forward for my customers to start contacting us through this chat app.
Yeahhhhh you are awesomee 🤗 Carlos is blushing when reading your words 🥰🥰🥰 Time to SCALE-UP guys 🔥🚀🔥🚀
_Carlos_
Thank you Omega Team for your quick response. I'd appreciate your support for fixing my concern about your app. Hope more users to use this app, it'll help you a lot especially when you need a live chat that redirects to messenger inbox.
Hi Promac PH,
Thanks for taking the time to leave us feedback! We really appreciate it. We are glad that you are happy with our app and customer support. Please feel free to contact us again if you need more help.
All the best,
Omega Team