O: WhatsApp Chat, Contact Form
Répond aux normes de qualité les plus strictes de Shopify en matière de rapidité, de simplicité d’utilisation et de valeur pour les marchands
Avis (560)
Affiner
-
Par note
Needed help, hope this was nothing, prove to be more complex. The came in, via TeamViewer and didn't quit until this work. I am very happy and impress just by the service. I really have high hope for this apps, now that i have seen them work. I recommend.
okokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokok
derwgregergrwgwegwegwegwegwegwegwegqegfqefgqwevgwrgwrgvqemnvklwjfwejkcfvowekdrjKvgfwerkjgvjwreogjvowrjgowrjkgjwrijgiwrjgijwrivgj
Hi jiew82633
We really appreciate that you enjoy using our app! Our customer service team will be glad to know about your review as they try very hard to help and be ...
So this is a bummer.... An app that is used for messaging and receiving from our customer, doesnt have an option to talk to their team support for help...that is something...sorry guys, its just not working properly
Hi there,
Thank you for taking the time to tell us why our app failed to meet your expectations. However we do have the option to contact with us via Facebook messenger ...
The app works perfectly. At the first time the widget does not appear but Tyler showed me how to fix this very easily. I just had to enable the app embed on the theme for the widget to show.
Thank you for your feedback! 😊 We're happy to hear that the Omega Messenger & Chat Buttons app is working perfectly for you. It's great that Tyler was able to help you get ...
The app is really simple and easy to set up. Can't wait to see how it works. You should give it a try too.
Its a good app at first I think but when I installed it, it never work again. even my friends open my website and tap on the messenger icon, it doesn't works at all.
Hello,
Thanks for your feedback!
I'm not sure the issue on your store, maybe due whitelist domain or restriction setup on facebook settings.
If you can, please reinstall app ...
Carlos was very polite and understood my problem right away. Basically the widget was not showing on my website and he immediately fixed. Great customer service and look forward for my customers to start contacting us through this chat app.
Yeahhhhh you are awesomee 🤗 Carlos is blushing when reading your words 🥰🥰🥰 Time to SCALE-UP guys 🔥🚀🔥🚀
_Carlos_
NUL. Si vous avez plusieurs pages Facebook, l'application ouvre le Live Chat sur n'importe laquelle. Du coup si vous avez des visiteurs qui ont des questions, ils voient une page Facebook qui n'a rien à voir avec votre site. Ce BUG est à corriger d'urgence !
Hello,
Thanks for your feedback!
The application can only connect to a single Facebook page to configure, so it depends on the page you are setting up.
I have checked and ...
Thank you Omega Team for your quick response. I'd appreciate your support for fixing my concern about your app. Hope more users to use this app, it'll help you a lot especially when you need a live chat that redirects to messenger inbox.
Hi Promac PH,
Thanks for taking the time to leave us feedback! We really appreciate it. We are glad that you are happy with our app and customer support. Please feel free to ...