O: WhatsApp Chat, Contact Form

O: WhatsApp Chat, Contact Form

리뷰 (560)

전체 평점
4.9
평점 수준당 개수
  • 평점의 92%가 별 5개입니다
  • 평점의 3%가 별 4개입니다
  • 평점의 2%가 별 3개입니다
  • 평점의 1%가 별 2개입니다
  • 평점의 2%가 별 1개입니다
2020년 12월 2일

Needed help, hope this was nothing, prove to be more complex. The came in, via TeamViewer and didn't quit until this work. I am very happy and impress just by the service. I really have high hope for this apps, now that i have seen them work. I recommend.

Joaillerie Zimm's
캐나다
앱 사용 기간 1일
2020년 2월 9일

okokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokok

tramphuloc
베트남
앱 사용 기간 1일
2021년 9월 17일

derwgregergrwgwegwegwegwegwegwegwegqegfqefgqwevgwrgwrgvqemnvklwjfwejkcfvowekdrjKvgfwerkjgvjwreogjvowrjgowrjkgjwrijgiwrjgijwrivgj

jiew82633
미국
앱 사용 기간 1일
답글 Omega개 2021년 9월 20일

Hi jiew82633

We really appreciate that you enjoy using our app! Our customer service team will be glad to know about your review as they try very hard to help and be ...

2020년 5월 22일

So this is a bummer.... An app that is used for messaging and receiving from our customer, doesnt have an option to talk to their team support for help...that is something...sorry guys, its just not working properly

Magic Flute
세르비아
앱 사용 기간 1일
답글 Omega개 2020년 6월 22일

Hi there,

Thank you for taking the time to tell us why our app failed to meet your expectations. However we do have the option to contact with us via Facebook messenger ...

2024년 8월 24일

The app works perfectly. At the first time the widget does not appear but Tyler showed me how to fix this very easily. I just had to enable the app embed on the theme for the widget to show.

Cuisine Pratique Polska
프랑스
앱 사용 기간 31분
답글 Omega개 2024년 8월 27일

Thank you for your feedback! 😊 We're happy to hear that the Omega Messenger & Chat Buttons app is working perfectly for you. It's great that Tyler was able to help you get ...

2019년 9월 22일

The app is really simple and easy to set up. Can't wait to see how it works. You should give it a try too.

October Bedding
베트남
앱 사용 기간 1일
2020년 4월 27일

Its a good app at first I think but when I installed it, it never work again. even my friends open my website and tap on the messenger icon, it doesn't works at all.

Hydromanshop
필리핀
앱 사용 기간 1일
답글 Omega개 2020년 4월 28일

Hello,
Thanks for your feedback!
I'm not sure the issue on your store, maybe due whitelist domain or restriction setup on facebook settings.
If you can, please reinstall app ...

2022년 5월 31일

Carlos was very polite and understood my problem right away. Basically the widget was not showing on my website and he immediately fixed. Great customer service and look forward for my customers to start contacting us through this chat app.

Ever Green Cloth
미국
앱 사용 기간 대략 20시간
답글 Omega개 2022년 6월 1일

Yeahhhhh you are awesomee 🤗 Carlos is blushing when reading your words 🥰🥰🥰 Time to SCALE-UP guys 🔥🚀🔥🚀
_Carlos_

2020년 4월 10일

NUL. Si vous avez plusieurs pages Facebook, l'application ouvre le Live Chat sur n'importe laquelle. Du coup si vous avez des visiteurs qui ont des questions, ils voient une page Facebook qui n'a rien à voir avec votre site. Ce BUG est à corriger d'urgence !

CLUB VIP France | Boutique Officielle.
프랑스
앱 사용 기간 대략 19시간
답글 Omega개 2020년 4월 10일

Hello,
Thanks for your feedback!
The application can only connect to a single Facebook page to configure, so it depends on the page you are setting up.
I have checked and ...

2021년 9월 20일

Thank you Omega Team for your quick response. I'd appreciate your support for fixing my concern about your app. Hope more users to use this app, it'll help you a lot especially when you need a live chat that redirects to messenger inbox.

Promac PH
필리핀
앱 사용 기간 대략 19시간
답글 Omega개 2021년 9월 20일

Hi Promac PH,

Thanks for taking the time to leave us feedback! We really appreciate it. We are glad that you are happy with our app and customer support. Please feel free to ...