Omega Messenger, WhatsApp Chat
Spełnia najwyższe standardy Shopify w zakresie płynności, łatwości użytkowania i korzyści dla sprzedawcy
Recenzje (522)
Zawęź
-
Według oceny
derwgregergrwgwegwegwegwegwegwegwegqegfqefgqwevgwrgwrgvqemnvklwjfwejkcfvowekdrjKvgfwerkjgvjwreogjvowrjgowrjkgjwrijgiwrjgijwrivgj
Hi jiew82633
We really appreciate that you enjoy using our app! Our customer service team will be glad to know about your review as they try very hard to help and be responsive to our users. Let us know whenever you have any questions about the app.
Best regards!
Omega Team
So this is a bummer.... An app that is used for messaging and receiving from our customer, doesnt have an option to talk to their team support for help...that is something...sorry guys, its just not working properly
Hi there,
Thank you for taking the time to tell us why our app failed to meet your expectations. However we do have the option to contact with us via Facebook messenger appears on your app store when you install our app and for some reasons, you could not see it on your store.
Please don't hesitate to contact us if you need any help.
Kind regards,
Kaylee
The app is really simple and easy to set up. Can't wait to see how it works. You should give it a try too.
Very easy to use! And the customer service is very good, they assisted me with some customization!
🌟 Thank you for your feedback! We're thrilled to hear that you find our Omega Facebook Messenger Chat app very easy to use. We're also delighted that you had a great experience with our customer service team, especially with the customization assistance. Your satisfaction is our priority, and we're committed to providing you with a seamless experience and excellent support. If you ever need further assistance or have any questions, feel free to reach out. We're here to help you make the most out of our app! 💫 #OmegaEaseOfUse
Its a good app at first I think but when I installed it, it never work again. even my friends open my website and tap on the messenger icon, it doesn't works at all.
Hello,
Thanks for your feedback!
I'm not sure the issue on your store, maybe due whitelist domain or restriction setup on facebook settings.
If you can, please reinstall app and let me know.
I'll check this.
Regards,
Kien
Carlos was very polite and understood my problem right away. Basically the widget was not showing on my website and he immediately fixed. Great customer service and look forward for my customers to start contacting us through this chat app.
Yeahhhhh you are awesomee 🤗 Carlos is blushing when reading your words 🥰🥰🥰 Time to SCALE-UP guys 🔥🚀🔥🚀
_Carlos_
NUL. Si vous avez plusieurs pages Facebook, l'application ouvre le Live Chat sur n'importe laquelle. Du coup si vous avez des visiteurs qui ont des questions, ils voient une page Facebook qui n'a rien à voir avec votre site. Ce BUG est à corriger d'urgence !
Hello,
Thanks for your feedback!
The application can only connect to a single Facebook page to configure, so it depends on the page you are setting up.
I have checked and found you are using another fb chat application at the same time. I think there is conflict with facebook sdk on your store.
Please contact us again to resolve this issue.
Regards,
Kien
Thank you Omega Team for your quick response. I'd appreciate your support for fixing my concern about your app. Hope more users to use this app, it'll help you a lot especially when you need a live chat that redirects to messenger inbox.
Hi Promac PH,
Thanks for taking the time to leave us feedback! We really appreciate it. We are glad that you are happy with our app and customer support. Please feel free to contact us again if you need more help.
All the best,
Omega Team
This team is very efficient and they responded promptly to questions. I am very grateful to Joy and her colleagues for helping me solve the problem. Recommend to everyone, they are really great! !
Hi Southood,
Thank you so much for your review. We are happy that you had a great experience with our app and customer service. Our team is always here to solve any of your problems. Please feel free to contact us again if you need more help.
Have a good day!
Omega Team
I used this app to help me connect better with my customer and i am very happy with the user experience