O: WhatsApp Chat, Contact Form
Spełnia najwyższe standardy Shopify w zakresie płynności, łatwości użytkowania i korzyści dla sprzedawcy
Recenzje (560)
Zawęź
-
Według oceny
App suddenly stopped working! I noticed that the replies here are that the FB page settings have age restrictions but I can assure that my page has no age restrictions. Very frustrating and I hated to delete it as I spent time to set it up with the color matching to my store, but I had no choice.
Hello there,
Thanks for your feedback!
When accessing Facebook, there is an error message "Sorry, something went wrong. We're working on getting this fixed as soon as we can. Go Back".
This is an error due to an overloaded Facebook server or a system error so you just need to wait patiently for a while to get in.
We cannot handle this error because it is related to Facebook's API system.
Regards,
Kien
Good One ! Very easy to set up in all fairness and works as advertised. No hidden costs or premium purchases required, what you see is what you get.
Needed help, hope this was nothing, prove to be more complex. The came in, via TeamViewer and didn't quit until this work. I am very happy and impress just by the service. I really have high hope for this apps, now that i have seen them work. I recommend.
the app is great to use. i was trying to use it for fb messenger and it seems to get the work done. Would recommend it especially because the feature which i was looking for - was free and easy to use. the app support team is good and gets work done pretty fast
Thank you for your time to leave this review. We appreciate the chance to support our customers with excellent experiences so your feedback is such a great motivation for us to provide outstanding services!
okokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokok
derwgregergrwgwegwegwegwegwegwegwegqegfqefgqwevgwrgwrgvqemnvklwjfwejkcfvowekdrjKvgfwerkjgvjwreogjvowrjgowrjkgjwrijgiwrjgijwrivgj
Hi jiew82633
We really appreciate that you enjoy using our app! Our customer service team will be glad to know about your review as they try very hard to help and be responsive to our users. Let us know whenever you have any questions about the app.
Best regards!
Omega Team
The app is really simple and easy to set up. Can't wait to see how it works. You should give it a try too.
I was able to receive a prompt response to my question and help from the team. They were able to fix the problem .
Hi Country Gal Thrift
Thank you so much for your review. We are happy that you had a great experience with our app and customer service. Our team is always here to solve any of your problems. Please feel free to contact us again if you need more help. Have a good day!
Kaylee - Omega Team
Chat function not working on my store. Reached out for support but have heard nothing yet. Will update rating when solved.
Hello,
Thanks for your feedback!
I have responded to your email 2 days ago, please check email sunroomplantwares@gmail.com
I have checked and see the issue: "Refused to display" from Facebook API.
I think the issue due to fb page missing whitelist domain or setup private age, country restrict
for manual add whitelist domain: https://developers.facebook.com/docs/messenger-platform/reference/messenger-profile-api/domain-whitelisting/
for setup restrict: https://developers.facebook.com/docs/messenger-platform/discovery/customer-chat-plugin/#login
Regards,
Kien
Beware of what you are giving this app in return for free use!
They inject another Facebook Pixel on my store, a pixel owned by them, collecting my customer data!
You can download the Facebook pixel helper chrome extension to see this for yourself.
UPDATED: Company wrote to me to clarify (as per below). Updated my rating from 1 to 3 stars. I am still not sure if I want to use this.
Hello there,
Thank you for taking your time to write us a review. However, there might be a misunderstanding here. Facebook has put Facebook pixel due to the same Facebook sdk between Facebook chat and pixel. Our app function is to display only, when the app includes sdk.js from Facebook, it also includes the pixel by Facebook default.
However, it does not affect your Pixel account, and we definitely do not collect any customer information from your store. In addition, Facebook does not allow that.
We do hope our explanation is clear enough to make sure there is no misunderstanding here which can affect our future merchants. We created the app to support merchants and build trust for our brand and this comment can make the customers misunderstood our purpose .
We have contacted you via email and contact number if you need any support or any further information.
Please get back to us.
We are looking forward to hearing from you.
Best regards,
Kien