O: WhatsApp Chat, Contact Form

O: WhatsApp Chat, Contact Form

Recensioni (560)

Valutazione complessiva
4,9
Numero di recensioni per livello
  • Il 92% delle recensioni ha 5 stelle
  • Il 3% delle recensioni ha 4 stelle
  • Il 2% delle recensioni ha 3 stelle
  • Il 1% delle recensioni ha 2 stelle
  • Il 2% delle recensioni ha 1 stelle
2 dicembre 2020

Needed help, hope this was nothing, prove to be more complex. The came in, via TeamViewer and didn't quit until this work. I am very happy and impress just by the service. I really have high hope for this apps, now that i have seen them work. I recommend.

Joaillerie Zimm's
Canada
1 giorno di utilizzo dell’app
9 febbraio 2020

okokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokokok

tramphuloc
Vietnam
1 giorno di utilizzo dell’app
17 settembre 2021

derwgregergrwgwegwegwegwegwegwegwegqegfqefgqwevgwrgwrgvqemnvklwjfwejkcfvowekdrjKvgfwerkjgvjwreogjvowrjgowrjkgjwrijgiwrjgijwrivgj

jiew82633
Stati Uniti
1 giorno di utilizzo dell’app
Omega ha risposto 20 settembre 2021

Hi jiew82633

We really appreciate that you enjoy using our app! Our customer service team will be glad to know about your review as they try very hard to help and be ...

22 maggio 2020

So this is a bummer.... An app that is used for messaging and receiving from our customer, doesnt have an option to talk to their team support for help...that is something...sorry guys, its just not working properly

Magic Flute
Serbia
1 giorno di utilizzo dell’app
Omega ha risposto 22 giugno 2020

Hi there,

Thank you for taking the time to tell us why our app failed to meet your expectations. However we do have the option to contact with us via Facebook messenger ...

24 agosto 2024

The app works perfectly. At the first time the widget does not appear but Tyler showed me how to fix this very easily. I just had to enable the app embed on the theme for the widget to show.

Cuisine Pratique Polska
Francia
31 minuti di utilizzo dell’app
Omega ha risposto 27 agosto 2024

Thank you for your feedback! 😊 We're happy to hear that the Omega Messenger & Chat Buttons app is working perfectly for you. It's great that Tyler was able to help you get ...

22 settembre 2019

The app is really simple and easy to set up. Can't wait to see how it works. You should give it a try too.

October Bedding
Vietnam
1 giorno di utilizzo dell’app
27 aprile 2020

Its a good app at first I think but when I installed it, it never work again. even my friends open my website and tap on the messenger icon, it doesn't works at all.

Hydromanshop
Filippine
1 giorno di utilizzo dell’app
Omega ha risposto 28 aprile 2020

Hello,
Thanks for your feedback!
I'm not sure the issue on your store, maybe due whitelist domain or restriction setup on facebook settings.
If you can, please reinstall app ...

31 maggio 2022

Carlos was very polite and understood my problem right away. Basically the widget was not showing on my website and he immediately fixed. Great customer service and look forward for my customers to start contacting us through this chat app.

Ever Green Cloth
Stati Uniti
Circa 20 ore di utilizzo dell’app
Omega ha risposto 1 giugno 2022

Yeahhhhh you are awesomee 🤗 Carlos is blushing when reading your words 🥰🥰🥰 Time to SCALE-UP guys 🔥🚀🔥🚀
_Carlos_

10 aprile 2020

NUL. Si vous avez plusieurs pages Facebook, l'application ouvre le Live Chat sur n'importe laquelle. Du coup si vous avez des visiteurs qui ont des questions, ils voient une page Facebook qui n'a rien à voir avec votre site. Ce BUG est à corriger d'urgence !

CLUB VIP France | Boutique Officielle.
Francia
Circa 19 ore di utilizzo dell’app
Omega ha risposto 10 aprile 2020

Hello,
Thanks for your feedback!
The application can only connect to a single Facebook page to configure, so it depends on the page you are setting up.
I have checked and ...

20 settembre 2021

Thank you Omega Team for your quick response. I'd appreciate your support for fixing my concern about your app. Hope more users to use this app, it'll help you a lot especially when you need a live chat that redirects to messenger inbox.

Promac PH
Filippine
Circa 19 ore di utilizzo dell’app
Omega ha risposto 20 settembre 2021

Hi Promac PH,

Thanks for taking the time to leave us feedback! We really appreciate it. We are glad that you are happy with our app and customer support. Please feel free to ...